PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.20129s0072.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family Nin-like
Protein Properties Length: 817aa    MW: 91353.5 Da    PI: 5.8212
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.20129s0072.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.71.3e-29548599152
                RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Bostr.20129s0072.1.p 548 AEKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 599
                           589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.2538619IPR003035RWP-RK domain
PfamPF020421.3E-25551599IPR003035RWP-RK domain
SuperFamilySSF542772.7E-23707804No hitNo description
SMARTSM006661.6E-24718801IPR000270PB1 domain
PROSITE profilePS5174527.138718801IPR000270PB1 domain
CDDcd064071.56E-36719795No hitNo description
Gene3DG3DSA:3.10.20.2401.5E-19719798No hitNo description
PfamPF005641.0E-17719799IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MENNYLPTDP AMDSSFMDGL LVEGCWLETT DASEFLNFSP STSVTPFDPS SFMWSPPTQD  60
TAICSSNSLS QVYAQDCAER SSLEDQGRDI SSFNRRWWIG PSGHGASVME RLVQAVTHIK  120
DFTSERGSLI QLWVPVDRGG KRVLTTKEQP FSHDPMCQRL ANYREISVNY QFSTEQEDSG  180
SNSDDLVGLP GRVFLGKVPE WTPDVRFFKN EEYPRVQHAQ DCDVRGTLAI PVFEQGSQNC  240
LGVIEVVMTT QMVKLSPDLE SICRALQAVD LRSTEVPIPP SLNGPDFSYQ AALPEIRNLL  300
RCACETQKLP LAQTWVSCLK QSKTGCRHND ENYIHCVSTI DDACYVGDPT VREFHEACSE  360
HHLLKGQGVV GEAFLTNGPC FSSDVSSYKK SEYPLSHHAT MFGLHGTVAI RLRCIHTGSA  420
DFVLEFFLPK NCRDIEEQRK MLNALSTLMA HVPRSLRTVT EKELEEEGDS IVREVIDRGV  480
ALPKIENTSE VQKSNSNPQN VGLVFDGGTT EMGELGSDYG RGLSVNENST FSSASGFSRI  540
TEKKRTKAEK NITLDVLRQY FAGSLKDAAK SIGVCPTTLK RICRQHGIQR WPSRKIKKVG  600
HSLQKIQRVI DSVEGVSGHH LPIGSFYANF PNLASSPEAS SLQQQSKKMT FLFSSNSQPT  660
KSPGSSCSHS SSCSSETQVN KEDPTDKTRQ ETMTLSRSFK ETQTTHLSSS TSSQEDDFLR  720
IKVTYEEEKI RFRMRNSHRL KDLLWEIAKR FSIEDVSRYD LKYLDEDNEW VLLRCDDDVE  780
ECVDVCRSFP GQTIKLLLQL SSQYLSERSS ASGCPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935370.0AB493537.1 Arabidopsis thaliana At1g76350 mRNA for hypothetical protein, partial cds, clone: RAAt1g76350.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006300747.10.0hypothetical protein CARUB_v100198120mg
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLR0I6G00.0R0I6G0_9BRAS; Uncharacterized protein
STRINGAT1G76350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein